• Home
  • About
  • Daily Prayer
  • Resources For Further Study

A simple, modern translation and explanation of the Bhagavad Gita with shloka (verse) meaning

~ Gita Journey is a straightforward, modern, contemporary, basic explanation and commentary of the Bhagawat Gita, with Sanskrit to English word meanings. Each shloka (verse) is explained in detail. An introduction to the Bhagavad Gita along with study resources can also be found here. A summary of each chapter of the Bhagavad Gita is also included. It does not matter whether you are a student, a retiree, a professional, a mom, a dad or a housewife – no prior knowledge is needed.

A simple, modern translation and explanation of the Bhagavad Gita with shloka (verse) meaning

Category Archives: sattvam

Bhagavad Gita Verse 40, Chapter 18

28 Friday Jun 2013

Posted by skr_2011 in 18.40, chapter 18 verse 40, deveshu, divi, ebhihi, gunaihe, muktam, prakritijaihi, prithvyaam, punaha, sattvam, syaat, tribhihi

≈ Comments Off on Bhagavad Gita Verse 40, Chapter 18

na tadasti prithvyaam vaa divi deveshu vaa punaha |
sattvam prakritijairmuktam yadebhihi syaattribhirgunaihe || 40 ||

 
There is no being on earth, or in heaven, or among the gods, or also in heaven, which can be free from the three gunaas born of Prakriti.
 
na : no
tat : that
asti : is
prithvyaam : on earth
vaa : or
divi : in heaven
deveshu : among gods
vaa : or
punaha : or also
sattvam : being
prakritijaihi : born of Prakriti
muktam : free
yat : which
ebhihi : these
syaat : there is
tribhihi : three
gunaihe : from gunaas
 
We are at the halfway mark of the eighteenth shloka, so let us recap what we have come across so far. The chapter began with Arjuna asking Shri Krishna about the difference between sanyaasa and tyaaga. Shri Krishna did not answer this question directly, but addressed the topic of karma yoga, which is the same as tyaaga. He ended this topic by declaring that the consequence or the fruit of action binds those who are attached to personal reward, and does not bind to those who are not attached. Next, he analyzed knowledge, action, agent, intellect, fortitude and happiness with the framework of the three gunaas, which is concluded with this shloka.
 
Shri Krishna summarizes this analysis by proclaiming the dominion of the three gunaas. He says that there is no being, object or entity, living or inert, that is beyond the influence of the gunaas. The gunaas work throughout the universe, and not just in a certain part of it, like the earth. We may be tempted to take this proclamation in a negative sense by accepting that there is no escape from the grip of Prakriti, no liberation. But that is not the case. The proclamation is meant to reinforce one of the central messages of the Gita, which is that Prakriti by itself is not the problem, it is our identification with Prakriti that is the problem we need to tackle.
 
The nature of this predicament was referenced in the fifteenth chapter through the illustration of the upside down tree which comprises the three gunaas. Only through the axe of detachment can this tree be destroyed. But, given that everything ultimately is under the influence of Prakriti, how can such a weapon be obtained? How can the identification with Prakriti be ended? Before this fundamental question is taken up, Shri Krishna spends a few shlokas on another preparatory topic next.

Bhagavad Gita Verse 1, Chapter 17

21 Sunday Apr 2013

Posted by skr_2011 in 17.1, aaho, anvitaahaa, chapter 17 verse 1, kaa, krishna, nishthaa, rajas, sattvam, shaastravidhim, shraddhayaa, tamaha, teshaam, utrisrijya, yajante

≈ Comments Off on Bhagavad Gita Verse 1, Chapter 17

Arjuna uvaacha:
ye shaastravidhimutrisrijya yajante shraddhayaanvitaahaa |
teshaam nishthaa tu kaa krishna sattvamoho rajastamaha || 1 ||

 
Arjuna said:
Those who, setting aside laws of scripture, perform worship endowed with faith, O Krishna, what is their position? Is it of sattva, rajas or tamas?

 
ye : those who
shaastravidhim : laws of scripture
utrisrijya : setting aside
yajante : perform worship
shraddhayaa : faith
anvitaahaa : endowed with
teshaam : their
nishthaa : position
tu : then
kaa : what
krishna : O Krishna
sattvam : sattva
aaho : or
rajas : rajas
tamaha : tamas
 
In order to prevent the prompting of actions by selfish desire, we should use the scriptures as a guide to decide what to do or what not to do. This was the concluding message of the previous chapter. Hearing this, the word “shaastra” or scripture stuck in Arjuna’s mind. Perhaps he foresaw that over the course of time, most people will not have access to scriptures. They will not be able to receive the guidance of a real guru who truly cares about their spiritual growth versus extracting money from them. He wanted to know, like all of us do, how to use our judgement without access to scriptural laws.
 
Let us now investigate what category of people Arjuna is speaking about. There are those who may have access to the scriptures, may even understand the scriptures, but have no inclination of following them. Such people were covered in the last chapter under the category of devilish qualities. Conversely, there are people who understand the scriptures and also conduct their life according to scriptures. These people were covered under the category of divine qualities. This chapter covers those people who do not have access to the scriptures, but yet try to lead their lives through faith, sincerity and honesty.
 
So then, Arjuna asks this extremely practical question on behalf of common people who have faith in some higher principle. Some may be devotees of Shri Krishna, some of Lord Shiva, some of Lord Ganesha. Some may not have faith in a deity but may have faith in a spiritual text such as the Gita. Some may have not have faith in any of these but may have faith in a friend, spouse or relative who has faith in a deity or a spiritual text. Some may have faith in their nation or in a higher cause such as improving the state of the nation’s education system.
 
Regardless of what their faith is, such people would like to set themselves on a path that gains them happiness in the material world, and also enables them to pursue the supreme goal of self realization or liberation. In the absence of scripture as the authority, faith determines the course of action for such people. How can they determine whether their faith is saattvic, rajasic or tamasic? How can they ensure that their faith is leading them in the right direction?

Bhagavad Gita Verse 11, Chapter 14

16 Saturday Feb 2013

Posted by skr_2011 in 14.11, asmin, chapter 14 verse 11, dehe, iti, jnyaanam, prakaashaha, sarvasvaareshu, sattvam, tadaa, upajaayate, uta, vidyaat, vivriddham, yadaa

≈ Comments Off on Bhagavad Gita Verse 11, Chapter 14

sarvasvaareshu dehesminprakaasha upajaayate |
jnyaanam yadaa tadaa vidyaadvivriddham sattvamityuta || 11 ||

 
When luminous knowledge radiates through all gates of this body, then one should know that sattva has increased greatly.
 
sarvasvaareshu : in all gates
dehe : body
asmin : this
prakaashaha : luminous
upajaayate : radiates
jnyaanam : knowledge
yadaa : when
tadaa : then
vidyaat : one should know
vivriddham : increased
sattvam : sattva
iti : this
uta : definitely
 
What are the marks of sattva? Shri Krishna says that when we see radiance, or when we see knowledge radiating from a person, we should know that we are in the presence of a highly sattvic person. The word “dvaara” usually means door or gate, but here it refers to the sense organs, our doors to the world. Even though the sense organs are meant from receiving stimuli from the world, they can also convey our internal state to the world. Our eyes, especially, can give away our thoughts. If our mind is wandering, our eyes will also wander, for instance. In a sattvic person, radiance shines through the sense organs, especially the eyes.
 
Now, we should not think that a highly sattvic person will radiate beams of light from their body. But they do radiate calmness and peace. We can sense peace if we are near them, or pick up on their calmness if we are watching them on a screen. Watch Dr. Jane Goodall speak about her efforts to save gorillas in Africa, and you will be drawn to the serenity on her face instantly. Such people harbour few, if any, selfish desires in their mind. This lack of dirt in the form of selfishness lets their inner radiance, the light of their eternal essence, shine through.
 
From our perspective, whenever we notice an increase in clear thinking, we should know that sattva is predominant in our mind. If we see fried food but the intellect prevents our hand from reaching to pick up that food, we are in a sattvic state. If our thoughts are towards the well-being of the family, our city or our nation, instead of just our narrow well-being, we are in a sattvic state. If our mind is sharp and alert, if we don’t let anything drop in our personal and professional lives, we are in a sattvic state.

Bhagavad Gita Verse 10, Chapter 14

15 Friday Feb 2013

Posted by skr_2011 in 14.10, abhibhooya, bhaarata, bhavati, chapter 14 verse 10, rajas, sattvam, tamas, tathaa

≈ Comments Off on Bhagavad Gita Verse 10, Chapter 14

rajastamaschaabhibhooya sattvam bhavati bhaarata |
rajaha sattvam tamaschaiva tamaha sattvam rajastathaa || 10 ||

 
Sattva rises, O Bhaarata, when it overpowers rajas and tamas, so does rajas overpower sattva and tamas, and also tamas overpowers sattva and rajas.
 
rajas : rajas
tamas : tamas
cha : and
abhibhooya : overpowers
sattvam : sattva
bhavati : rises
bhaarata : O Bhaarata
rajaha : rajas
sattvam : sattva
tamas : tamas
cha : and
eva : similarly
tamaha : tamas
sattvam : sattva
rajas : rajas
tathaa : similarly
 
Now that we have a basic understanding of the properties of the three gunaas, we need to go one level deeper. We know that our mind is always under the influence of the three gunaas, since it is made up of those very three gunaas. How do these three gunaas impact the mind? Do they work in parallel or do they work in sequence? Is there any one gunaa that is more powerful than the other?
 
Shri Krishna says that our mind can only be under the impact of one gunaa at a time. This happens when one gunaa assumes dominance, and consequently, asserts its authority over the others. When sattva is dominant, it dominates over rajas and tamas. Similarly, rajas dominates over the other two and tamas over the other two. All three gunaas are at war with each other in our mind. When one gunaa achieves victory, it temporarily defeats the others.
 
Having known this, we now would like to know which gunaa within us dominates more than others. This is not an easy question to answer, because we have to analyze ourselves and not anyone else. We need to look within. We need to understand what thoughts, feelings and emotions should we watch out for so that we can tie them back to a specific gunaa. If we conduct this analysis for a while, we will know which gunaa predominates. Shri Krishna expands on the topic of the marks or signs of each gunaa in the next shloka.

Bhagavad Gita Verse 9, Chapter 14

14 Thursday Feb 2013

Posted by skr_2011 in 14.9, aavritya, bhaarata, chapter 14 verse 9, jnyaanam, karmani, pramaade, rajaha, sanjayati, sattvam, sukham, tamaha, uta

≈ Comments Off on Bhagavad Gita Verse 9, Chapter 14

sattvam sukham sanjayati rajaha karmani bhaarata |
jnyaanamaavritya tu tamaha pramaade sanjayatyuta || 9 ||

 
Sattva binds through joy, rajas through action, O Bhaarata, while tamas cloaks knowledge and binds through heedlessness.
 
sattvam : sattva
sukham : joy
sanjayati : binds
rajaha : rajas
karmani : action
bhaarata : O Bhaarata
jnyaanam : knowledge
aavritya : cloaks
tu : while
tamaha : tamas
pramaade : heedlessness
sanjayati : binds
uta : and
 
Shri Krishna recaps the characteristics of the three gunaas in this shloka. Sattva binds by making us hold on to joy experienced after attaining a sense object. Rajas binds us by giving us joy in performing actions and obtaining their results. Tamas binds us by giving us joy in holding on to laziness and heedlessness. We now begin to look into how these three are interrelated.
 
In the second chapter, we have come across a series of shlokas that describe how the mind can fall from sattva into rajas and tamas in a matter of seconds. We start with the mind resting in a peaceful sattvic state. A tinge of rajas comes in, causing us to think about some sense object, let’s say a sweet. This fuels rajas further, creating a strong attachment to that sweet, culminating in a strong desire to do anything to get that sweet. But it gets worse. If we cannot get that sweet, if someone or something obstructs our consumption of the sweet, anger arises in us. Rajas deteriorates into tamas. The last rung of the ladder of fall is when anger goes to such an extent that it causes us to lose our faculty of intelligence and memory.
 
Conversely, we can go from tamas to rajas to sattva, but it may take a little longer. For someone steeped in tamas, immersing themself in action will raise them to the level of rajas. When action becomes focused and directed towards the pursuit of a selfless goal, rajas is elevated to the level of sattva. Swami Vivekananda always used to say “awake, arise, stop not till the goal is reached”. When India was under British rule, many had become accustomed to this slavery and had fallen into a tamasic state. They could not find a way out of their predicament, and were clouded in ignorance. Swami Vivekananda’s message urged citizens to engage in action towards independence. That was the only way to get them out of the tamasic state of laziness.

Bhagavad Gita Verse 6, Chapter 14

11 Monday Feb 2013

Posted by skr_2011 in 14.6, anaamayam, anagha, badhnaati, chapter 14 verse 6, jnyaanasangena, nirmalatvaat, prakaasham, sattvam, sukhasangena, tatra

≈ Comments Off on Bhagavad Gita Verse 6, Chapter 14

tatra sattvam nirmalatvaatprakaashamanaamayam |
sukhasangena badhnaati jnyaanasangena chaanagha || 6 ||

 
Of these, sattva is pure, bright and healthy. It binds through attachment to joy and attachment to knowledge, O sinless one.
 
tatra : of these
sattvam : satvva
nirmalatvaat : pure
prakaasham : bright
anaamayam : healthy
sukhasangena : attachment to joy
badhnaati : binds
jnyaanasangena : attachment to knowledge
cha : and
anagha : O sinless one
 
In simple terms, our mind is in a state of sattva whenever we experience joy, peace and calmness. We are alert, our mind is able to think very logically, we are able to grasp the most complex statements that we read or hear, and we don’t feel the need to rush out into the world.
 
Shri Krishna says that sattva refers to purity, brightness and health. Our mind can be compared to the water in a glass cup. When the pond is free from agitation, and all the dirt has settled down, it is crystal clear and is able to reflect light beautifully. Similarly, when our mind is in a state of sattva, there is absence of dirt in the form of selfish desires. There is brightness because it is able to reflect the light of the self, the awareness of the self, without any hinderance. There is health because it enables us to get as close to our natural state of joy as is possible in the human body.
 
Now, no matter how enjoyable or pleasant this state is, Shri Krishna reminds us that sattva has the ability to bind us, to trap us, because anyone will like to remain in a state of joy and calmness. Furthermore, if we foresee that this state will go away, we would like to hold on to this state of joy tightly and not let it go. Sattva can also bind us through attachment to knowledge. Since sattva enables our mind to accumulate more and more worldly knowledge, read more books, attain more academic qualifications, and ultimately pump up our ego, we get attached to it even more.
 
Why is sattva able to bind us to joy and knowledge? We mistake the joy provided by sattva because we have not experienced what real joy is. That can only happen in meditation when we are able to access the joy that is inherent in the “I”, in the self. All other joys are in the realm of Prakriti – temporary, perishable, and illusory. True joy is in the subject, the “I”, not in the object. Sattva, though preferable to rajas and tamas, is to be used for getting us closer to the goal of liberation, and has to be ultimately discarded, just like the fire is turned off after we cook our meal.

Bhagavad Gita Verse 5, Chapter 14

10 Sunday Feb 2013

Posted by skr_2011 in 14.5, avyayam, chapter 14 verse 5, dehe, dehinam, gunaahaa, iti, mahaabaaho, nibandhanti, prakritisambhavaahaa, rajaha, sattvam, tamaha

≈ Comments Off on Bhagavad Gita Verse 5, Chapter 14

sattvam rajastama iti gunaahaa prakritisambhavaahaa |
nibandhanti mahaabaaho dehe dehinamavyayam || 5 ||

 
Sattva, rajas, tamas, these gunaas born of Prakriti, O mighty-armed warrior, bind the imperishable body dweller to the body.
 
sattvam : sattva
rajaha : rajas
tamaha : tamas
iti : these
gunaahaa : gunaas
prakritisambhavaahaa : born of Prakriti
nibandhanti : bind
mahaabaaho : O mighty-armed warrior
dehe : to the body
dehinam : body dweller
avyayam : imperishable
 
Shri Krishna beings the detailed analysis of Prakriti with two points. First, he breaks down Prakriti into its three components: the gunaas which are sattva, rajas and tamas. We have to note that the phrase “born of” in the shloka does not mean that Prakriti creates the three gunaas. It means that Prakriti itself is nothing but the three gunaas. Next, Shri Krishna states the effect of Prakriti on the Purusha, also known as the jeeva, the individual soul. He says that Prakriti binds or ties down the imperishable body dweller, the “dehi”, the jeeva, to the body.
 
Let us begin by understanding what the term “gunaa” means. From our point of view, gunaa is a state of mind. In just one day, we experience calmness, passion and lethargy, which are roughly equal to sattva, rajas and tamas respectively. From a broader point of view, gunaas refer to building blocks of the universe. Inert matter is tamas, action or dynamism is rajas, and harmony is sattva. Since we are primarily interested in liberation from our sorrow, we shall focus on the impact of the gunaas on our mind rather than their impact on the universe.
 
Now, if we have repeatedly heard that our self is imperishable and can never be bound, then how can the perishable gunaas bind the self? The answer is : the gunaas by themselves do not bind us. Ignorance of our true nature, followed by our mis-identification with the body, puts us in a situation where we ourselves allow the gunaas to take over control of our life.
 
Imagine that you have parked your car on the left side of road. A car that looks just like your car is also parked on the same road, but on the right side of the road. After you come out of the building and absent-mindedly think that the other car is yours, you are trapped. You see a new scratch on the car and get upset, you get a parking ticket and have to pay the fine, and so on. The other car has not “bound” you, but your incorrect knowledge has done so. We can also go back to the example of the child watching the boxing match. He is as though glued to the screen, while his grandmother is not. The TV does not bind him since it is is nothing but millions of red, blue and green dots of light. It is the child’s strong identification with the boxer that binds him.
 
Similarly, the individual soul which has mis-identified itself with the body, gets entrapped in the play of the three gunaas. In the next three shlokas, Shri Krishna takes up each gunaa one by one, and explains its power to bind the body in detail.

Bhagavad Gita Verse 26, Chapter 13

27 Sunday Jan 2013

Posted by skr_2011 in 13.26, bharatarshabha, chapter 13 verse 26, jangamam, kinchit, kshetrakshetrajnyasamyogaat, sanjaayate, sattvam, sthaavaraha, tat, viddhi, yaavat

≈ Comments Off on Bhagavad Gita Verse 26, Chapter 13

yaavatsanjaayate kinchitsattvam sthaavarjangamam |
kshetrakshetrajnyasamyogaattadviddhi bharatarshabha || 26 ||

 
Whatever being is born, inert or moving, know that to have come from the union of kshetra and kshetrajnya, O foremost among the Bharatas.
 
yaavat : whatever
sanjaayate : born
kinchit : any
sattvam : being
sthaavaraha : inert
jangamam : moving
kshetrakshetrajnyasamyogaat : union of kshetra and kshetrajnya
tat : that
viddhi : know
bharatarshabha : O foremost among the Bharatas
 
We now shift our attention from the nature of the “I” to the nature of the world. We may be able to experience our true nature as the saakshi, the witness, in deep meditation. But most of us still have to transact in this world, still deal with our friends, our relatives, our co-workers and so on. How should our attitude be towards the world after we have understood, at least in theory, what our true nature is? We cannot, and should not, think of ourselves as something special, and as everyone else as useless forms on an IMAX screen, per the illustration used in previous shlokas. Now, in this sequence of shlokas, we learn to develop the right attitude, the right vision towards the world.
 
Shri Krishna begins this topic by asserting that every other being in the universe has come into existence just like we have. The kshetrajnya, the higher aspect of Prakriti, has identified itself with the kshetra, the lower aspect of Prakriti. Each such erroneous identification creates the Purusha, also known as the jeeva, the individual soul. Subsequently, each Purusha has developed attachment to the qualities of Prakriti, accumulating selfish desires or karmas in the process. Billions of Purushas live out their lives in this world trying to exhaust their karmas, but in most cases, end up accumulating more karmas, and therefore, take birth again.
 
We have spoken of this erroneous identification several times, but have not delved into it deeply. The classic example to explain this erroneous identification is that of a burning hot iron ball. The iron ball has taken on heat, which is the property of fire. On the other hand, fire which is normally without shape, has taken on the property of the iron ball, which is round. Two things taking on each other’s properties is known as “anyonya adhyaasa” or mutual superimposition. The Purusha’s real nature is infinite, full of knowledge and bliss. Prakriti’s nature is finite, inert and sorrowful. Erroneous identification results in them exchanging their properties, as it were. This is how the Purusha assumes inertness of the body.
 
So our daily life is nothing but a Purusha interacting with several other Purushas, all of which are under the effect of this erroneous identification. There should be no hint of any arrogance that causes us to treat others differently just because we think that we have acquired more knowledge than them. In fact, whenever we emphasize differences between one another rather than similarities, even in worldly matters, we slip further away from liberation. But, developing an attitude of sameness towards everyone becomes difficult, especially when our minds are conditioned to differentiate rather than unify. Keeping this in mind, we learn to develop the correct attitude towards the world in the next shloka.

Bhagavad Gita Verse 36, Chapter 10

06 Saturday Oct 2012

Posted by skr_2011 in 10.36, aham, asmi, chalayataam, chapter 10 verse 36, dyootam, jayaha, sattvam, sattvavataamaham, tejaha, tejasvinaam, vyavasaayaha

≈ Comments Off on Bhagavad Gita Verse 36, Chapter 10

dyootam chalayataamasmi tejastejasvinaamaham |
jayosmi vyavasaayosmi sattvam sattvavataamaham || 36 ||

 
Among deceitful pursuits, I am gambling. I am the splendour in the brilliant and I am victory and determination. I am the Sattva of Saatvic individuals.
 
dyootam : gambling
chalayataam : among the deceitful
asmi : I am
tejaha : splendour
tejasvinaam : brilliant
aham : I am
jayaha : victory
asmi : I am
vyavasaayaha : determination
asmi : I am
sattvam : Sattva
sattvavataamaham : Saatvic individuals
 
As we have seen throughout the Gita, Ishvara uses the power of his maaya to create this universe of duality. So if everything that we consider “good” is Ishvara, its polar opposite is also Ishvara. To underscore this point, Shri Krishna brings forward gambling as Ishvara’s manifestation.
 
Most of us are under the sway of maaya. If we let maaya have her way, she can steal our faculty of discrimination, our intellect that can distinguish right from wrong. Of all the possible ways of deluding and deceiving us, gambling is the strongest form of maaya. Like any addiction, it can cause great attachment and ultimately result in great sorrow. In the Srimad Bhaagavatam, the demon Kali was asked to reside wherever there is gambling.
 
Conversely, there are those among us who are endowed with a sharp intellect, one that never loses its power of discrimination. Nobel prize winners, freedom fighters, scientists, the list goes on. Shri Krishna says that it is Ishvara who is shining as the brilliance of such luminaries. Whenever we come across such individuals, we may feel inferior against their prowess. But there is no need to do so, because it is Ishvara that is giving them their brilliance.
 
Even if most of us are not endowed with such intellectual faculties, we can accomplish great things if we are hardworking, industrious and focused. People with very little mental and financial resources, through blood, sweat and tears, have shown that it is possible to succeed in spite of their limitations. Shri Krishna says that Ishvara manifests as their hard work, and also as the victory that comes as a result of this effort.
 
Sattva, along with rajas and tamas, comprise the three basic building blocks of maaya or prakriti. When any system is working in perfect harmony, without any fluctuations or disturbances, we can say that the Sattva quality has manifested. So when our intellect is functioning without any agitations, when we see things clearly, it indicates that sattva has dominated over rajas and tamas. Ishvara manifests as this sattva in people who demonstrate virtues such as modesty, calmness, sobriety and goodness.

New! Youtube Channel

All shokas (verses) available here:

Most Visited Verses

  • Bhagavad Gita Verse 13, Chapter 13
  • Summary Of Chapter 7
  • Bhagavad Gita Verse 1, Chapter 1
  • Bhagavad Gita Verse 78, Chapter 18
  • Summary of Bhagavad Gita Chapter 13
  • Summary of Chapter 8
  • Bhagavad Gita Verse 17, Chapter 2
  • Bhagavad Gita Verse 8, Chapter 8
  • Bhagavad Gita Chapter 6, Verse 10
  • Bhagavad Gita Verse 27, Chapter 11

Give Feedback

Email the author: gkmdisc at hotmail.com

Books By The Author

The entire Gita book written by the author of this blog, as well as shorter, easier to read versions of the Gita are available here.

Create a free website or blog at WordPress.com.

Privacy & Cookies: This site uses cookies. By continuing to use this website, you agree to their use.
To find out more, including how to control cookies, see here: Cookie Policy
  • Subscribe Subscribed
    • A simple, modern translation and explanation of the Bhagavad Gita with shloka (verse) meaning
    • Join 124 other subscribers
    • Already have a WordPress.com account? Log in now.
    • A simple, modern translation and explanation of the Bhagavad Gita with shloka (verse) meaning
    • Subscribe Subscribed
    • Sign up
    • Log in
    • Report this content
    • View site in Reader
    • Manage subscriptions
    • Collapse this bar